Abstract: Glucagon, a 29-amino acid peptide hormone, primarily functions to raise blood glucose by stimulating hepatic glycogenolysis and gluconeogenesis. In the peptide product market, its key uses include emergency hypoglycemia treatment, diagnostic aid in imaging, and metabolic research. Current market trends show a CAGR of 7.8% (2023-2030), driven by diabetes and obesity research. Leading brands like Novo Nordisk and Eli Lilly dominate, with purity >98% and strict GMP certifications. Product selection prioritizes stability, endotoxin levels (<0.5 EU/mg), and cold-chain logistics (2-8°C). Industry advantages include high specificity; drawbacks include short half-life requiring formulation optimization.
Target Keyword: what is the function of gluc
To answer the question what is the function of glucagon, one must first recognize it as a 29-amino acid peptide hormone secreted by pancreatic alpha cells. Its primary biological role is to raise blood glucose levels by stimulating hepatic glycogenolysis and gluconeogenesis. In the peptide product market, this function is harnessed for emergency hypoglycemia treatment, diagnostic imaging, and metabolic research. The molecular structure of glucagon products typically features a molecular weight of approximately 3483 Da, with a sequence of HSQGTFTSDYSKYLDSRRAQDFVQWLMNT. High-purity glucagon peptides, often exceeding 98% purity via HPLC analysis, are essential for consistent biological activity. The function of glucagon is directly tied to its ability to bind to the glucagon receptor (GCGR), activating G-protein coupled signaling pathways that trigger glucose release from the liver. For product developers, understanding what is the function of glucagon at the molecular level is critical for formulation stability, as the peptide is prone to aggregation and degradation at temperatures above 8°C.
The global glucagon peptide market is experiencing robust growth, with a compound annual growth rate (CAGR) of 7.8% projected from 2023 to 2030. This expansion is primarily driven by increasing diabetes and obesity research, where the function of glucagon in counter-regulating insulin is pivotal. Market data from 2023 indicates that the glucagon segment accounted for approximately USD 1.2 billion in revenue, with North America holding a 45% market share. Key market trends include the development of stable liquid formulations to replace traditional lyophilized powders, reducing reconstitution errors. The function of glucagon in dual-agonist therapies, such as GLP-1/glucagon co-agonists for weight loss, is a major innovation driver. Industry reports show that over 60% of new peptide product applications in 2024 involve glucagon analogs with extended half-lives. The market trend toward personalized medicine is also influencing glucagon product development, with formulations tailored for pediatric and geriatric populations. For companies answering what is the function of glucagon in their product lines, the shift from emergency-only use to chronic metabolic management represents a significant opportunity.
When evaluating what is the function of glucagon across different brands, Novo Nordisk and Eli Lilly dominate the market with their established glucagon products. Novo Nordisk's GlucaGen is a lyophilized powder for injection, with a purity of >99% and endotoxin levels below 0.5 EU/mg. Eli Lilly's Baqsimi, a nasal powder formulation, offers a non-invasive alternative with a bioavailability of approximately 30% compared to injectable forms. In terms of stability, GlucaGen maintains potency for 24 months at 2-8°C, while Baqsimi is stable at room temperature for 18 months. The function of glucagon in these products is identical at the molecular level, but formulation differences impact onset of action: injectable glucagon achieves peak plasma concentration in 10-15 minutes, whereas nasal glucagon reaches peak in 20-30 minutes. For research-grade glucagon, brands like Bachem and Sigma-Aldrich offer products with purity >98% and endotoxin levels <0.1 EU/mg, suitable for in vivo studies. A comparative analysis of brand pricing shows that generic glucagon products are 30-40% cheaper than branded versions, but may lack the same batch-to-batch consistency. When considering what is the function of glucagon in clinical settings, the choice between brands often depends on storage logistics and patient compliance requirements.
The primary technical advantage of glucagon peptide products is their high specificity for the glucagon receptor, enabling precise glucose elevation without off-target effects. This specificity is crucial when answering what is the function of glucagon in emergency settings, as it allows for rapid reversal of severe hypoglycemia within 5-10 minutes. Another advantage is the well-characterized pharmacokinetic profile: glucagon has a half-life of 3-6 minutes in circulation, which minimizes prolonged hyperglycemic effects. However, the short half-life is also a major disadvantage, requiring formulation optimization through PEGylation, fatty acid conjugation, or encapsulation in lipid nanoparticles. Data from recent studies show that PEGylated glucagon analogs can extend half-life to 2-4 hours, but may reduce receptor binding affinity by 15-20%. The function of glucagon is also limited by its instability in aqueous solutions; glucagon peptides are prone to deamidation and oxidation at pH levels above 7.0. To mitigate this, manufacturers use lyophilization and require strict cold-chain logistics at 2-8°C. Another technical drawback is the potential for immunogenicity, with anti-glucagon antibodies detected in 5-8% of patients after repeated use. For product developers, balancing the function of glucagon with formulation stability remains a key challenge, with current research focusing on cyclic peptide analogs that resist enzymatic degradation.
A detailed parameter comparison is essential for understanding what is the function of glucagon in different product grades. For clinical-grade glucagon, key parameters include purity (>98% by HPLC), endotoxin levels (<0.5 EU/mg), and peptide content (95-105% of labeled amount). Research-grade glucagon typically requires purity >95% and endotoxin levels <1.0 EU/mg. The function of glucagon is directly influenced by its aggregation state; dynamic light scattering (DLS) analysis should show a monomeric content of >90% to ensure optimal receptor binding. For lyophilized products, residual moisture content must be <3% to maintain stability. A comparison of leading products shows that Novo Nordisk's GlucaGen has a pH of 2.5-3.5 after reconstitution, while Eli Lilly's Baqsimi has a pH of 5.0-6.0. The function of glucagon in nasal formulations requires a specific particle size distribution (10-50 microns) for optimal absorption. For custom peptide synthesis, manufacturers provide certificates of analysis (COA) detailing mass spectrometry confirmation, amino acid analysis, and purity by HPLC. When selecting products, buyers should verify that the function of glucagon is validated through in vitro bioassays measuring cAMP accumulation in HEK293 cells expressing the glucagon receptor. These parameters ensure that the peptide product meets the required biological activity for its intended use.
The function of glucagon extends across five key product uses in the peptide market. First, emergency hypoglycemia treatment remains the most critical application, with glucagon products used to reverse severe hypoglycemia in diabetic patients. Second, glucagon is used as a diagnostic aid in imaging, particularly for gastrointestinal motility studies and pancreatic imaging. Third, metabolic research utilizes glucagon to study glucose homeostasis, insulin secretion, and hepatic glucose production. Fourth, glucagon is employed in cardiac research for its positive inotropic effects, though this use is less common. Fifth, the function of glucagon in dual-agonist therapies for obesity and type 2 diabetes is a rapidly growing application, with products like cotadutide showing 12-15% weight loss in clinical trials. The scope of glucagon product uses is expanding beyond traditional indications, with research into glucagon-like peptide-1 (GLP-1) and glucagon co-agonists for non-alcoholic steatohepatitis (NASH). For each use, the function of glucagon must be carefully matched to the formulation: injectable forms for acute care, nasal forms for patient self-administration, and research-grade forms for laboratory studies. The market for glucagon in diagnostic imaging is projected to grow at 6.5% CAGR through 2030, driven by increased use in endoscopic procedures.
The current brand status of glucagon products shows a market dominated by established pharmaceutical companies with strong regulatory compliance. Novo Nordisk holds approximately 40% market share, followed by Eli Lilly at 30%, with generic manufacturers accounting for the remainder. When evaluating what is the function of glucagon in brand selection, factory qualifications are paramount. GMP (Good Manufacturing Practice) certification is mandatory for all glucagon peptide products, with audits conducted by regulatory bodies like the FDA and EMA. Key factory qualifications include ISO 9001:2015 for quality management, ISO 14001 for environmental management, and specific certifications for peptide synthesis facilities. The function of glucagon production requires specialized equipment for solid-phase peptide synthesis (SPPS) and HPLC purification. Leading factories maintain batch sizes of 100-500 grams for clinical-grade glucagon, with yield rates of 60-70% after purification. For research-grade products, factories offer custom synthesis with batch sizes as small as 10 mg. The brand status of glucagon products is also influenced by patent expirations; with several patents expiring between 2025-2028, generic competition is expected to increase. Factory qualification documents should include a Drug Master File (DMF) for regulatory submissions, ensuring that the function of glucagon is consistently reproduced across batches.
Product certifications are critical for verifying what is the function of glucagon in regulated markets. Essential certifications include a Certificate of Analysis (COA) detailing purity, peptide content, and endotoxin levels. A Certificate of Origin is required for international shipments, confirming the manufacturing location. For clinical use, a Certificate of Compliance with GMP standards is mandatory, including documentation of sterility testing and stability studies. The function of glucagon in research settings requires a Certificate of Conformance to the specified purity grade. Additional certifications include MSDS (Material Safety Data Sheet) for handling and transportation, and a Certificate of Stability showing shelf-life data under recommended storage conditions. For products used in human clinical trials, an Investigational Medicinal Product Dossier (IMPD) is required, detailing the function of glucagon in the specific formulation. Quality assurance documents should also include batch production records, raw material certificates, and validation reports for analytical methods. When purchasing glucagon peptides, buyers should request a Certificate of Analysis with specific data on the function of glucagon as measured by receptor binding assays. These certifications ensure traceability and regulatory compliance, which are essential for both clinical and research applications.
Selecting the right glucagon product requires careful evaluation of what is the function of glucagon in the intended application. For clinical use, prioritize products with purity >98%, endotoxin levels <0.5 EU/mg, and GMP certification. For research use, purity >95% is acceptable, but ensure the product includes a COA with HPLC and mass spectrometry data. The function of glucagon in emergency settings demands products with rapid onset; injectable forms are preferred over nasal forms for immediate use. When comparing suppliers, request batch-specific stability data showing the function of glucagon maintained over 24 months at 2-8°C. Logistics considerations are critical: glucagon peptides require cold-chain shipping at 2-8°C, with temperature monitors in each shipment. Data shows that 15% of glucagon products are compromised during transport due to temperature excursions. For international shipments, use validated cold-chain carriers with 24-48 hour delivery windows. The function of glucagon in lyophilized form allows for longer storage, but reconstitution must be performed immediately before use. For bulk purchases, negotiate volume discounts and request stability data for the specific batch. Always verify that the product's certificate of analysis matches the claimed specifications, particularly for the function of glucagon in receptor binding assays. These selection tips ensure that the peptide product meets the required quality and performance standards.
Q: What is the function of glucagon in the body? A: The primary function of glucagon is to raise blood glucose levels by stimulating the liver to convert stored glycogen into glucose and promoting gluconeogenesis. It acts as a counter-regulatory hormone to insulin, maintaining glucose homeostasis.
Q: How is glucagon used in peptide products? A: Glucagon peptide products are used for emergency treatment of severe hypoglycemia, as a diagnostic aid in imaging studies, and in metabolic research. The function of glucagon in these products is identical to its natural biological role.
Q: What purity is required for glucagon products? A: Clinical-grade glucagon products require purity >98% by HPLC, while research-grade products typically require >95% purity. The function of glucagon is directly affected by purity, as impurities can reduce receptor binding affinity.
Q: How should glucagon products be stored? A: Glucagon products must be stored at 2-8°C in a refrigerator, protected from light. Lyophilized products have a shelf life of 24-36 months, while reconstituted solutions must be used within 24 hours. The function of glucagon degrades rapidly at temperatures above 25°C.
Q: What are the side effects of glucagon products? A: Common side effects include nausea, vomiting, and headache. The function of glucagon in raising blood glucose can cause transient hyperglycemia. Allergic reactions are rare but possible, occurring in less than 1% of users.
Q: Can glucagon be used for weight loss? A: Glucagon alone is not used for weight loss, but dual-agonist therapies combining glucagon with GLP-1 are being developed for obesity treatment. The function of glucagon in these therapies is to increase energy expenditure and reduce appetite.
Q: What certifications should glucagon products have? A: Essential certifications include GMP compliance, Certificate of Analysis, Certificate of Origin, and stability data. For clinical use, additional regulatory approvals from FDA or EMA are required. The function of glucagon must be validated through bioassays.
Q: How long does glucagon take to work? A: Injectable glucagon raises blood glucose within 5-15 minutes, while nasal glucagon takes 20-30 minutes. The function of glucagon in emergency settings requires rapid administration to prevent neurological damage from severe hypoglycemia.